Skip to content

⚠ For research use only — NOT intended for use on humans or animals. This site is informational, does not provide medical advice and does not replace the advice of a healthcare professional.

RALPEP
EN
FrançaisEnglish
Metabolism & Body CompositionApprouvé FDAClinicalTrials.gov ↗

Tésamoréline

Tesamorelin (analogue synthétique de la GHRH)

Tesamorelin is a synthetic analogue of GHRH (Growth Hormone Releasing Hormone) that naturally stimulates the secretion of growth hormone (GH) by the pituitary gland, promoting a targeted reduction in visceral fat and an overall improvement in body composition.

ProtocolReconstitution
Reconstitution
10 mg + 2 ml
5000 mcg/ml
Usual dose
1–2 mg
beginner 1 mg
Frequency
7×/wk
In the evening, 30 to 60 minutes before bedtime (on an empty stomach or after a light meal)
Administration
Subcutaneous injection (SC)
Abdomen · Thighs · Glutes · Upper arms

Chemical identity

Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (analogue GHRH 1-44, C-term amidé)
Molecular formula
C221H366N72O67S
Molecular weight
5135.76 g/mol
CAS no.
218949-48-5

Purity (HPLC) measures the absence of related impurities; it is distinct from net peptide content, since salts and counter-ions (acetate, TFA) count toward the vial mass. Account for this when computing the real concentration at reconstitution.

1

Potential benefits

Abdominal fat reduction

Targets visceral fat for a leaner silhouette and a significant decrease in deep abdominal fat.

GH stimulation

Naturally increases the pulsatile secretion of growth hormone while respecting physiological rhythms.

Metabolic improvement

Improves metabolism and promotes the use of fat as an energy source.

Body composition

Improves the lean mass / fat mass ratio and preserves lean mass even in a caloric deficit.

Muscle definition

Promotes better definition and preserves lean mass for a leaner physique.

Performance

Optimizes energy, recovery, and overall performance.

2

Mechanism of action

  • Hypothalamic stimulation: Tesamorelin mimics GHRH and stimulates the hypothalamus.
  • Pituitary stimulation: increases the pulsatile secretion of GH by the pituitary gland.
  • GH release: GH is released into the blood in a physiological, pulsatile manner.
  • Peripheral action: GH acts on metabolism, promoting lipolysis and the preservation of lean mass.
  • IGF-1 production: the liver produces IGF-1 in response to GH, amplifying its anabolic and metabolic effects.
3

Historical milestones

Research milestones, clinical trials and regulatory steps.

  1. 2000s

    GHRH analog TH9507

    Theratechnologies develops tesamorelin, a 44-amino-acid GH-releasing factor modified with a hexenoyl group to extend its stability.

  2. 2007

    Phase 3 results

    Falutz and colleagues report in the NEJM a marked reduction in visceral fat in HIV patients on antiretroviral therapy.

  3. 2010

    FDA approval (EGRIFTA)

    On 10 November 2010 the FDA approves EGRIFTA, the first treatment for HIV-associated lipodystrophy with excess abdominal fat.

  4. 2025

    New EGRIFTA WR formulation

    In March 2025 the FDA approves the F8 formulation (EGRIFTA WR), more concentrated and easier to reconstitute.

4

Evolution over time

01
First weeks

Gradual improvement in energy, recovery, and sleep quality.

02
Short term

Better insulin sensitivity, increased fat oxidation, and improved blood glucose management.

03
Medium term

Visible decrease in visceral fat, reduced waist circumference, and better muscle definition.

04
Long term

Lasting body recomposition, preservation of lean mass, and overall improvement in metabolic health.

5

Dosages & protocol

Reference dosages

Beginner
Assess tolerance
1 mg
Common use
Most used dosage
1–2 mg
High
Experienced users
2 mg
Cycle
12 wk
Timing
In the evening, 30 to 60 minutes before bedtime (on an empty stomach or after a light meal)
Half-life
Very short plasma half-life (roughly 8-38 minutes); the GH and IGF-1 rise it triggers lasts far longer, which is why it is dosed daily.

Reconstitution

10 mg
vial
+
2 ml
BAC water
=
5
mg/ml
Open the calculator →

Tesamorelin vs GHRP

Tesamorelin favors a clean, physiological, and lasting stimulation, with a specific impact on visceral fat and metabolic health.

  • Stimulates GH release in a physiological way, without increasing appetite.
  • Increases GH and IGF-1 with a cleaner action and fewer side effects.
  • Ideal for visceral fat reduction and metabolic health.
  • GHRP strongly stimulates GH (via ghrelin) but can increase appetite and targets visceral fat less.

Recommended dilution (10 mg vial)

Concentrations obtained according to the volume of bacteriostatic water added (U-100 syringe).

  • 1 ml of BAC → 10 mg/ml → 100 mcg per unit.
  • 2 ml of BAC → 5 mg/ml → 50 mcg per unit.
  • 3 ml of BAC → 3.33 mg/ml → 33 mcg per unit.

Required equipment & best practices

  • Vial of lyophilized Tesamorelin (10 mg) and bacteriostatic water (BAC).
  • Sterile syringes (1 ml / 0.5 ml) and injection needles (29G-31G).
  • Alcohol swabs and a sharps container.
  • Inject at 90° (or 45° if very lean), slowly and without rubbing, then immediately dispose of needles in a suitable sharps container.
  • Never leave at room temperature and keep out of reach of children.

Usage tips

  • Start low, go slow, and increase the dose gradually.
  • Assess individual response and adjust based on results and goals.
  • Store the reconstituted solution in the refrigerator (2-8°C) and use within 20 to 30 days.
  • Always use sterile technique and clean, disinfected equipment.
  • Do not inject at the same site twice in the same day; rotate between abdomen, thighs, glutes, or upper arms.
  • Combine with a suitable diet and consistent training; consistency and discipline are the keys to success.

Good to know / effects to watch

  • Studies on GHRH analogues report arthralgia (joint pain) and peripheral edema.
  • Paresthesia (tingling, numbness in the extremities) may be observed.
  • Redness, itching, or discomfort at the injection site.
  • Headaches reported within the class.
  • Possible impact on insulin sensitivity and blood glucose: to be monitored.
  • Known hypersensitivity to Tesamorelin or any of its excipients: to be avoided. Consult a healthcare professional if in doubt.
  • Pregnancy, breastfeeding, and a history of GH-sensitive tumors: caution advised; consult a healthcare professional if in doubt.

Storage

  • Before reconstitution: store the lyophilized powder refrigerated (2-8 °C), protected from light.
  • After reconstitution: keep refrigerated (2-8 °C) and use within the recommended window (bacteriostatic-water preparations keep cold for up to ~28 days).
  • Do not freeze the reconstituted solution; protect it from light.

Contraindications

  • Pregnancy: contraindicated (animal teratogenicity including hydrocephaly). Breastfeeding: avoid.
  • Active malignancy: contraindicated; any preexisting tumor must be inactive and treated before use.
  • Disruption of the hypothalamic-pituitary axis (hypophysectomy, hypopituitarism, pituitary surgery/radiation/trauma): contraindicated.
  • Active proliferative diabetic retinopathy; diabetes: monitor blood glucose (GH class effect).
  • Known hypersensitivity to tesamorelin or mannitol; not advised in children.
6

Possible synergistic combinations

The catalog peptides are clickable — to complete or optimize your protocol.

CJC-1295

May potentiate the effects on GH secretion.

View the sheet & add →
GHRP-6

Possible synergy on growth hormone release.

Controlled diet & regular training

Synergy to maximize body recomposition and metabolic health.

Sources & references

Links to external sources (scientific databases, trial registries, authorities). RAL Pep is not responsible for their content.

Stacks & combinations with this peptide

💪

Body composition

GH axis & body composition

A GHRH + GHRP combination: Tesamorelin (a GHRH analogue) and Ipamorelin (a selective GHRP) stimulate the natural release of GH synergistically and in a pulsed manner.

TésamorélineGHRH analogue — amplitude of the GH peak
IpamorelinSelective GHRP — triggers a clean peak (little ghrelin/cortisol)

Why it works

A GHRH (Tesamorelin) and a GHRP (Ipamorelin) act on two different receptors: combined, they produce a GH release greater than the sum of each, while respecting physiological pulsatility.

  • Inject in the evening on an empty stomach to respect the nocturnal GH peak.
  • Monitor water retention and insulin sensitivity.

⚠ For research use only. NOT intended for use on humans or animals. The values shown are indicative and for informational purposes ; each person reacts differently. This guide does not replace medical advice — consult a healthcare professional if in doubt.